Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (2 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Putative endonuclease APE1501 [143523] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [143524] (1 PDB entry) |
Domain d2cwja1: 2cwj A:4-119 [130924] |
PDB Entry: 2cwj (more details), 3.6 Å
SCOP Domain Sequences for d2cwja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]} apkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegagysm ddivkvtvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlyt
Timeline for d2cwja1: