SCOPe 2.08: Domain d2cvzc1: 2cvz C:158-289

Lineage for d2cvzc1 (2cvz C:158-289)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species)
   forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively

7. Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries)
   structural genomics

8. Domain d2cvzc1: 2cvz C:158-289 [130894]
   Other proteins in same PDB: d2cvza2, d2cvzb2, d2cvzc2, d2cvzd2
   automatically matched to d1j3va1
   complexed with ndp

Details for d2cvzc1

PDB Entry: 2cvz, 1.8 Å

PDB Description: Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus HB8

PDB Compounds: (C:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2cvzc1:

Sequence; same for both SEQRES and ATOM records:

>d2cvzc1 a.100.1.1 (C:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir

Timeline for d2cvzc1:

• d2cvzc1 first appeared in SCOP 1.73
  
• d2cvzc1 appears in SCOPe 2.07