| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
| Protein Hydroxyisobutyrate dehydrogenase [101357] (4 species) forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively |
| Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries) structural genomics |
| Domain d2cvzb1: 2cvz B:158-289 [130892] Other proteins in same PDB: d2cvza2, d2cvzb2, d2cvzc2, d2cvzd2 automatically matched to d1j3va1 complexed with ndp |
PDB Entry: 2cvz (more details), 1.8 Å
SCOPe Domain Sequences for d2cvzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvzb1 a.100.1.1 (B:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir
Timeline for d2cvzb1: