![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
![]() | Protein Hydroxyisobutyrate dehydrogenase [102171] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102172] (2 PDB entries) structural genomics |
![]() | Domain d2cvza2: 2cvz A:2-157 [130891] Other proteins in same PDB: d2cvza1, d2cvzb1, d2cvzc1, d2cvzd1 automatically matched to d1j3vc2 complexed with ndp |
PDB Entry: 2cvz (more details), 1.8 Å
SCOPe Domain Sequences for d2cvza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts gaeagtltvmlggpeeavervrpflayakkvvhvgp
Timeline for d2cvza2: