Lineage for d2cv5b1 (2cv5 B:25-102)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909520Protein Histone H4 [47125] (5 species)
  7. 909521Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)
  8. 909541Domain d2cv5b1: 2cv5 B:25-102 [130848]
    Other proteins in same PDB: d2cv5a_, d2cv5c1, d2cv5d1, d2cv5e_, d2cv5g1, d2cv5h1
    automatically matched to d1p3ob_
    protein/DNA complex; complexed with cl, mn

Details for d2cv5b1

PDB Entry: 2cv5 (more details), 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d2cv5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cv5b1 a.22.1.1 (B:25-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2cv5b1:

Click to download the PDB-style file with coordinates for d2cv5b1.
(The format of our PDB-style files is described here.)

Timeline for d2cv5b1: