| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (7 species) |
| Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (1 PDB entry) Uniprot P28001 11-118 |
| Domain d2cv5g1: 2cv5 G:15-118 [130853] Other proteins in same PDB: d2cv5a_, d2cv5b1, d2cv5d1, d2cv5e_, d2cv5f1, d2cv5h1 automatically matched to 2CV5 C:11-118 protein/DNA complex; complexed with cl, mn |
PDB Entry: 2cv5 (more details), 2.5 Å
SCOPe Domain Sequences for d2cv5g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cv5g1 a.22.1.1 (G:15-118) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
Timeline for d2cv5g1: