SCOPe 2.04: Domain d2cnwc2: 2cnw C:89-293

Lineage for d2cnwc2 (2cnw C:89-293)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (17 PDB entries)

8. Domain d2cnwc2: 2cnw C:89-293 [130654]
   Other proteins in same PDB: d2cnwa1, d2cnwb1, d2cnwc1, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
   automated match to d1okka2
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwc2

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (C:) signal recognition particle protein

SCOPe Domain Sequences for d2cnwc2:

Sequence; same for both SEQRES and ATOM records:

>d2cnwc2 c.37.1.10 (C:89-293) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilg

Timeline for d2cnwc2:

• d2cnwc2 first appeared in SCOP 1.73
  
• d2cnwc2 appears in SCOPe 2.03
  
• d2cnwc2 appears in SCOPe 2.05
  
• d2cnwc2 appears in the current release, SCOPe 2.08