Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries) |
Domain d2cnwc2: 2cnw C:89-293 [130654] Other proteins in same PDB: d2cnwa1, d2cnwb1, d2cnwc1, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2 automatically matched to d2ffha3 complexed with 5gp, alf, gdp, mg |
PDB Entry: 2cnw (more details), 2.39 Å
SCOP Domain Sequences for d2cnwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwc2 c.37.1.10 (C:89-293) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy fagvsekpeglepfyperlagrilg
Timeline for d2cnwc2: