Lineage for d2cn4a_ (2cn4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943155Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2943156Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2943157Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 2943169Protein automated matches [190253] (1 species)
    not a true protein
  7. 2943170Species Serratia marcescens [TaxId:615] [187035] (2 PDB entries)
  8. 2943171Domain d2cn4a_: 2cn4 A: [130634]
    automated match to d1b2va_
    complexed with hem, po4

Details for d2cn4a_

PDB Entry: 2cn4 (more details), 2.3 Å

PDB Description: the crystal structure of the secreted dimeric form of the hemophore hasa reveals a domain swapping with an exchanged heme ligand
PDB Compounds: (A:) hemophore hasa

SCOPe Domain Sequences for d2cn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cn4a_ d.35.1.1 (A:) automated matches {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOPe Domain Coordinates for d2cn4a_:

Click to download the PDB-style file with coordinates for d2cn4a_.
(The format of our PDB-style files is described here.)

Timeline for d2cn4a_: