Lineage for d1b2va_ (1b2v A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943155Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 2943156Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) (S)
  5. 2943157Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins)
    automatically mapped to Pfam PF06438
  6. 2943158Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 2943159Species Serratia marcescens [TaxId:615] [54624] (6 PDB entries)
  8. 2943162Domain d1b2va_: 1b2v A: [38532]
    complexed with ca, hem

Details for d1b2va_

PDB Entry: 1b2v (more details), 1.9 Å

PDB Description: heme-binding protein a
PDB Compounds: (A:) protein (heme-binding protein a)

SCOPe Domain Sequences for d1b2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2va_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOPe Domain Coordinates for d1b2va_:

Click to download the PDB-style file with coordinates for d1b2va_.
(The format of our PDB-style files is described here.)

Timeline for d1b2va_: