PDB entry 1b2v

View 1b2v on RCSB PDB site
Description: heme-binding protein a
Class: transport protein
Keywords: heme acquisition, iron metabolism, transport protein
Deposited on 1998-12-01, released 1999-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.177
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (heme-binding protein a)
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b2va_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b2vA (A:)
    mafsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaisst
    anqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnl
    sslqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqha
    dspellaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b2vA (A:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata