Lineage for d1b2va_ (1b2v A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31714Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
  4. 31715Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family) (S)
  5. 31716Family d.35.1.1: Heme-binding protein A (HasA) [54622] (1 protein)
  6. 31717Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 31718Species Serratia marcescens [TaxId:615] [54624] (3 PDB entries)
  8. 31721Domain d1b2va_: 1b2v A: [38532]

Details for d1b2va_

PDB Entry: 1b2v (more details), 1.9 Å

PDB Description: heme-binding protein a

SCOP Domain Sequences for d1b2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2va_ d.35.1.1 (A:) Heme-binding protein A (HasA) {Serratia marcescens}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOP Domain Coordinates for d1b2va_:

Click to download the PDB-style file with coordinates for d1b2va_.
(The format of our PDB-style files is described here.)

Timeline for d1b2va_: