Lineage for d2cn4a1 (2cn4 A:2-174)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721264Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily)
    beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432
  4. 721265Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (1 family) (S)
  5. 721266Family d.35.1.1: Heme-binding protein A (HasA) [54622] (1 protein)
  6. 721267Protein Heme-binding protein A (HasA) [54623] (1 species)
  7. 721268Species Serratia marcescens [TaxId:615] [54624] (5 PDB entries)
  8. 721272Domain d2cn4a1: 2cn4 A:2-174 [130634]
    automatically matched to d1b2va_
    complexed with hem, po4

Details for d2cn4a1

PDB Entry: 2cn4 (more details), 2.3 Å

PDB Description: the crystal structure of the secreted dimeric form of the hemophore hasa reveals a domain swapping with an exchanged heme ligand
PDB Compounds: (A:) hemophore hasa

SCOP Domain Sequences for d2cn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cn4a1 d.35.1.1 (A:2-174) Heme-binding protein A (HasA) {Serratia marcescens [TaxId: 615]}
afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata

SCOP Domain Coordinates for d2cn4a1:

Click to download the PDB-style file with coordinates for d2cn4a1.
(The format of our PDB-style files is described here.)

Timeline for d2cn4a1: