![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.35: Heme-binding protein A (HasA) [54620] (1 superfamily) beta-alpha-beta(6)-alpha(2); antiparallel sheet: order 165432 |
![]() | Superfamily d.35.1: Heme-binding protein A (HasA) [54621] (2 families) ![]() |
![]() | Family d.35.1.1: Heme-binding protein A (HasA) [54622] (2 proteins) automatically mapped to Pfam PF06438 |
![]() | Protein automated matches [190253] (1 species) not a true protein |
![]() | Species Serratia marcescens [TaxId:615] [187035] (2 PDB entries) |
![]() | Domain d2cn4b_: 2cn4 B: [130635] automated match to d1b2va_ complexed with hem, po4 |
PDB Entry: 2cn4 (more details), 2.3 Å
SCOPe Domain Sequences for d2cn4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cn4b_ d.35.1.1 (B:) automated matches {Serratia marcescens [TaxId: 615]} afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaata
Timeline for d2cn4b_: