Lineage for d2cmea1 (2cme A:9-98)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825507Fold b.164: SARS ORF9b-like [141665] (1 superfamily)
    complex dimeric fold with three intersubunit beta-sheets packed around a single core
  4. 2825508Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) (S)
  5. 2825509Family b.164.1.1: SARS ORF9b-like [141667] (2 proteins)
    PfamB PB005852
  6. 2825510Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species)
  7. 2825511Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry)
    Uniprot P59636 9-98
  8. 2825512Domain d2cmea1: 2cme A:9-98 [130621]
    complexed with d10

Details for d2cmea1

PDB Entry: 2cme (more details), 2.8 Å

PDB Description: the crystal structure of sars coronavirus orf-9b protein
PDB Compounds: (A:) hypothetical protein 5

SCOPe Domain Sequences for d2cmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmea1 b.164.1.1 (A:9-98) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]}
vppalhlvdpqiqltitadpkvypiilrlgsnlslsmarrnldslearafqstpivvqmt
klatteelpdefvvvtak

SCOPe Domain Coordinates for d2cmea1:

Click to download the PDB-style file with coordinates for d2cmea1.
(The format of our PDB-style files is described here.)

Timeline for d2cmea1: