PDB entry 2cme

View 2cme on RCSB PDB site
Description: the crystal structure of sars coronavirus orf-9b protein
Class: hypothetical protein
Keywords: alternative open reading frame, lipid-binding, virus assembly, hypothetical protein
Deposited on 2006-05-06, released 2006-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.266
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59636 (18-77)
      • conflict (31)
    Domains in SCOPe 2.07: d2cmea1
  • Chain 'B':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmeb1
  • Chain 'C':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmec_
  • Chain 'D':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmed_
  • Chain 'E':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmee1
  • Chain 'F':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmef_
  • Chain 'G':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmeg_
  • Chain 'H':
    Compound: hypothetical protein 5
    Species: HUMAN SARS CORONAVIRUS [TaxId:227859]
    Domains in SCOPe 2.07: d2cmeh_
  • Heterogens: D10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeA (A:)
    vppalhlvdpqiqltitadpkvypiilrlgsnlslsmarrnldslearafqstpivvqmt
    klatteelpdefvvvtak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeB (B:)
    vppalhlvdpqiqltitradpkvypiilrlgsnlslsmarrnldslearafqstpivvqm
    tklatteelpdefvvvtak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeC (C:)
    ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
    atteelpdefvvvtak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeD (D:)
    ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
    atteelpdefvvvtak
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeE (E:)
    vppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtk
    latteelpdefvvvtak
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeF (F:)
    ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
    atteelpdefvvvtak
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeG (G:)
    vppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtk
    latteelpdefvvvtak
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmeH (H:)
    ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
    atteelpdefvvvtak