Lineage for d2cmef_ (2cme F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825507Fold b.164: SARS ORF9b-like [141665] (1 superfamily)
    complex dimeric fold with three intersubunit beta-sheets packed around a single core
  4. 2825508Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) (S)
  5. 2825509Family b.164.1.1: SARS ORF9b-like [141667] (2 proteins)
    PfamB PB005852
  6. 2825510Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species)
  7. 2825511Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry)
    Uniprot P59636 9-98
  8. 2825517Domain d2cmef_: 2cme F: [130626]
    automated match to d2cmec1
    complexed with d10

Details for d2cmef_

PDB Entry: 2cme (more details), 2.8 Å

PDB Description: the crystal structure of sars coronavirus orf-9b protein
PDB Compounds: (F:) hypothetical protein 5

SCOPe Domain Sequences for d2cmef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmef_ b.164.1.1 (F:) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]}
ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
atteelpdefvvvtak

SCOPe Domain Coordinates for d2cmef_:

Click to download the PDB-style file with coordinates for d2cmef_.
(The format of our PDB-style files is described here.)

Timeline for d2cmef_: