Lineage for d2cmed_ (2cme D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.164: SARS ORF9b-like [141665] (1 superfamily)
    complex dimeric fold with three intersubunit beta-sheets packed around a single core
  4. Superfamily b.164.1: 'SARS ORF9b-like [141666] (1 family) (S)
  5. Family b.164.1.1: SARS ORF9b-like [141667] (2 proteins)
    PfamB PB005852
  6. Protein Hypothetical protein 5 (ORF-9b) [141668] (1 species)
  7. Species SARS coronavirus [TaxId:227859] [141669] (1 PDB entry)
    Uniprot P59636 9-98
  8. Domain d2cmed_: 2cme D: [130624]
    automated match to d2cmec1
    complexed with d10

Details for d2cmed_

PDB Entry: 2cme (more details), 2.8 Å

PDB Description: the crystal structure of sars coronavirus orf-9b protein
PDB Compounds: (D:) hypothetical protein 5

SCOPe Domain Sequences for d2cmed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmed_ b.164.1.1 (D:) Hypothetical protein 5 (ORF-9b) {SARS coronavirus [TaxId: 227859]}
ppalhlvdpqiqltitdpkvypiilrlgsnlslsmarrnldslearafqstpivvqmtkl
atteelpdefvvvtak

SCOPe Domain Coordinates for d2cmed_ are not available.

Timeline for d2cmed_:

Domains from other chains:
(mouse over for more information)
d2cmea1, d2cmeb1, d2cmec_, d2cmee1, d2cmef_, d2cmeg_, d2cmeh_