Lineage for d2cm3b_ (2cm3 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130872Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2130873Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2130985Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2131193Protein automated matches [190252] (3 species)
    not a true protein
  7. 2131194Species Human (Homo sapiens) [TaxId:9606] [187034] (28 PDB entries)
  8. 2131213Domain d2cm3b_: 2cm3 B: [130612]
    automated match to d1bzja_
    complexed with ca

Details for d2cm3b_

PDB Entry: 2cm3 (more details), 2.1 Å

PDB Description: structure of protein tyrosine phosphatase 1b (c2)
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d2cm3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cm3b_ c.45.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
feqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhqedndy
inaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkcaqywp
qkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpdfgvpe
spasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdpssvdi
kkvllemrkfrmgliqtadqlrfsylaviegakfi

SCOPe Domain Coordinates for d2cm3b_:

Click to download the PDB-style file with coordinates for d2cm3b_.
(The format of our PDB-style files is described here.)

Timeline for d2cm3b_: