![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) ![]() |
![]() | Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
![]() | Protein Mannose-specific lectin RS-IIL [101593] (1 species) |
![]() | Species Ralstonia solanacearum [TaxId:305] [101594] (3 PDB entries) |
![]() | Domain d2chha_: 2chh A: [130471] automated match to d1uqxa_ complexed with bma, ca, man, unx |
PDB Entry: 2chh (more details), 1 Å
SCOPe Domain Sequences for d2chha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chha_ b.115.1.1 (A:) Mannose-specific lectin RS-IIL {Ralstonia solanacearum [TaxId: 305]} aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg
Timeline for d2chha_: