SCOP 1.73: Domain d2chha1: 2chh A:1-113

Lineage for d2chha1 (2chh A:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)

6. Protein Mannose-specific lectin RS-IIL [101593] (1 species)

7. Species Ralstonia solanacearum [TaxId:305] [101594] (2 PDB entries)

8. Domain d2chha1: 2chh A:1-113 [130471]
   automatically matched to d1uqxa_
   complexed with bma, ca, man, unx

Details for d2chha1

PDB Entry: 2chh, 1 Å

PDB Description: ralstonia solanacearum high-affinity mannose-binding lectin

PDB Compounds: (A:) protein rsc3288

SCOP Domain Sequences for d2chha1:

Sequence; same for both SEQRES and ATOM records:

>d2chha1 b.115.1.1 (A:1-113) Mannose-specific lectin RS-IIL {Ralstonia solanacearum [TaxId: 305]}
aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg

Timeline for d2chha1:

• d2chha1 is new in SCOP 1.73
  
• d2chha1 appears in SCOP 1.75
  
• d2chha1 appears in the current release, SCOPe 2.08, called d2chha_