Lineage for d1uqxa_ (1uqx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821276Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2821277Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2821278Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2821327Protein Mannose-specific lectin RS-IIL [101593] (1 species)
  7. 2821328Species Ralstonia solanacearum [TaxId:305] [101594] (3 PDB entries)
  8. 2821331Domain d1uqxa_: 1uqx A: [99801]
    complexed with ca, mma

Details for d1uqxa_

PDB Entry: 1uqx (more details), 1.7 Å

PDB Description: ralstonia solanacearum lectin (rs-iil) in complex with alpha- methylmannoside
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1uqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqxa_ b.115.1.1 (A:) Mannose-specific lectin RS-IIL {Ralstonia solanacearum [TaxId: 305]}
aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg

SCOPe Domain Coordinates for d1uqxa_:

Click to download the PDB-style file with coordinates for d1uqxa_.
(The format of our PDB-style files is described here.)

Timeline for d1uqxa_: