Class b: All beta proteins [48724] (180 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
Protein Mannose-specific lectin RS-IIL [101593] (1 species) |
Species Ralstonia solanacearum [TaxId:305] [101594] (3 PDB entries) |
Domain d1uqxa_: 1uqx A: [99801] complexed with ca, mma |
PDB Entry: 1uqx (more details), 1.7 Å
SCOPe Domain Sequences for d1uqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uqxa_ b.115.1.1 (A:) Mannose-specific lectin RS-IIL {Ralstonia solanacearum [TaxId: 305]} aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg
Timeline for d1uqxa_: