PDB entry 2chh

View 2chh on RCSB PDB site
Description: ralstonia solanacearum high-affinity mannose-binding lectin
Class: lectin
Keywords: lectin, sugar-binding protein, d-mannose, plant pathogen, hypothetical protein
Deposited on 2006-03-15, released 2006-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.1
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein rsc3288
    Species: RALSTONIA SOLANACEARUM [TaxId:305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2chha_
  • Heterogens: CA, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chhA (A:)
    maqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgs
    gaikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chhA (A:)
    aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
    aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg