SCOP 1.75: Domain d2cfia1: 2cfi A:204-307

Lineage for d2cfia1 (2cfi A:204-307)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families)

5. Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)

6. Protein 10-formyltetrahydrofolate dehydrogenase domain 2 [101807] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141380] (2 PDB entries)
   Uniprot O75891 204-307

8. Domain d2cfia1: 2cfi A:204-307 [130382]
   Other proteins in same PDB: d2cfia2
   automatically matched to 2BW0 A:204-307
   complexed with so4, zzz

Details for d2cfia1

PDB Entry: 2cfi, 1.85 Å

PDB Description: the hydrolase domain of human 10-fthfd in complex with 6-formyltetrahydropterin

PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOP Domain Sequences for d2cfia1:

Sequence; same for both SEQRES and ATOM records:

>d2cfia1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]}
qkketakinwdqpaeaihnwirgndkvpgawteaceqkltffnstlntsglvpegdalpi
pgahrpgvvtkaglilfgnddkmllvkniqledgkmilasnffk

Timeline for d2cfia1:

• d2cfia1 first appeared in SCOP 1.73
  
• d2cfia1 appears in SCOPe 2.01
  
• d2cfia1 appears in the current release, SCOPe 2.08