Lineage for d2cfia1 (2cfi A:204-307)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794501Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2794502Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2794503Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 2794504Protein 10-formyltetrahydrofolate dehydrogenase domain 2 [101807] (2 species)
  7. 2794505Species Human (Homo sapiens) [TaxId:9606] [141380] (2 PDB entries)
    Uniprot O75891 204-307
  8. 2794507Domain d2cfia1: 2cfi A:204-307 [130382]
    Other proteins in same PDB: d2cfia2, d2cfia3
    automated match to d2bw0a1
    complexed with so4, zzz

Details for d2cfia1

PDB Entry: 2cfi (more details), 1.85 Å

PDB Description: the hydrolase domain of human 10-fthfd in complex with 6-formyltetrahydropterin
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d2cfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfia1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]}
qkketakinwdqpaeaihnwirgndkvpgawteaceqkltffnstlntsglvpegdalpi
pgahrpgvvtkaglilfgnddkmllvkniqledgkmilasnffk

SCOPe Domain Coordinates for d2cfia1:

Click to download the PDB-style file with coordinates for d2cfia1.
(The format of our PDB-style files is described here.)

Timeline for d2cfia1: