PDB entry 2cfi

View 2cfi on RCSB PDB site
Description: the hydrolase domain of human 10-fthfd in complex with 6-formyltetrahydropterin
Class: oxidoreductase
Keywords: tetrahydrofolate, folate binding, nadp, one-carbon metabolism, oxidoreductase, phosphopantetheine
Deposited on 2006-02-21, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.181
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10-formyltetrahydrofolate dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75891 (22-328)
      • expression tag (19-21)
    Domains in SCOPe 2.08: d2cfia1, d2cfia2, d2cfia3
  • Heterogens: SO4, ZZZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cfiA (A:)
    mhhhhhhssgvdlgtenlyfqsmkiavigqslfgqevychlrkeghevvgvftvpdkdgk
    adplgleaekdgvpvfkysrwrakgqalpdvvakyqalgaelnvlpfcsqfipmeiisap
    rhgsiiyhpsllprhrgasainwtlihgdkkggfsifwaddgldtgdlllqkecevlpdd
    tvstlynrflfpegikgmvqavrliaegkaprlpqpeegatyegiqkketakinwdqpae
    aihnwirgndkvpgawteaceqkltffnstlntsglvpegdalpipgahrpgvvtkagli
    lfgnddkmllvkniqledgkmilasnffk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cfiA (A:)
    fqsmkiavigqslfgqevychlrkeghevvgvftvpdkdgkadplgleaekdgvpvfkys
    rwrakgqalpdvvakyqalgaelnvlpfcsqfipmeiisaprhgsiiyhpsllprhrgas
    ainwtlihgdkkggfsifwaddgldtgdlllqkecevlpddtvstlynrflfpegikgmv
    qavrliaegkaprlpqpeegatyegiqkketakinwdqpaeaihnwirgndkvpgawtea
    ceqkltffnstlntsglvpegdalpipgahrpgvvtkaglilfgnddkmllvkniqledg
    kmilasnffk