Lineage for d2cfia2 (2cfi A:1-203)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892512Family c.65.1.1: Formyltransferase [53329] (5 proteins)
  6. 2892513Protein 10-formyltetrahydrofolate dehydrogenase domain 1 [102552] (2 species)
  7. 2892514Species Human (Homo sapiens) [TaxId:9606] [142568] (2 PDB entries)
    Uniprot O75891 1-203
  8. 2892516Domain d2cfia2: 2cfi A:1-203 [130383]
    Other proteins in same PDB: d2cfia1, d2cfia3
    automated match to d2bw0a2
    complexed with so4, zzz

Details for d2cfia2

PDB Entry: 2cfi (more details), 1.85 Å

PDB Description: the hydrolase domain of human 10-fthfd in complex with 6-formyltetrahydropterin
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOPe Domain Sequences for d2cfia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfia2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]}
mkiavigqslfgqevychlrkeghevvgvftvpdkdgkadplgleaekdgvpvfkysrwr
akgqalpdvvakyqalgaelnvlpfcsqfipmeiisaprhgsiiyhpsllprhrgasain
wtlihgdkkggfsifwaddgldtgdlllqkecevlpddtvstlynrflfpegikgmvqav
rliaegkaprlpqpeegatyegi

SCOPe Domain Coordinates for d2cfia2:

Click to download the PDB-style file with coordinates for d2cfia2.
(The format of our PDB-style files is described here.)

Timeline for d2cfia2: