Lineage for d2cfia1 (2cfi A:204-307)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670147Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 670148Superfamily b.46.1: FMT C-terminal domain-like [50486] (2 families) (S)
  5. 670149Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 670150Protein 10-formyltetrahydrofolate dehydrogenase domain 2 [101807] (2 species)
  7. 670151Species Human (Homo sapiens) [TaxId:9606] [141380] (2 PDB entries)
  8. 670153Domain d2cfia1: 2cfi A:204-307 [130382]
    Other proteins in same PDB: d2cfia2
    automatically matched to 2BW0 A:204-307
    complexed with so4, zzz

Details for d2cfia1

PDB Entry: 2cfi (more details), 1.85 Å

PDB Description: the hydrolase domain of human 10-fthfd in complex with 6-formyltetrahydropterin
PDB Compounds: (A:) 10-formyltetrahydrofolate dehydrogenase

SCOP Domain Sequences for d2cfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfia1 b.46.1.1 (A:204-307) 10-formyltetrahydrofolate dehydrogenase domain 2 {Human (Homo sapiens) [TaxId: 9606]}
qkketakinwdqpaeaihnwirgndkvpgawteaceqkltffnstlntsglvpegdalpi
pgahrpgvvtkaglilfgnddkmllvkniqledgkmilasnffk

SCOP Domain Coordinates for d2cfia1:

Click to download the PDB-style file with coordinates for d2cfia1.
(The format of our PDB-style files is described here.)

Timeline for d2cfia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cfia2