SCOPe 2.07: Domain d2cead1: 2cea D:411-606

Lineage for d2cead1 (2cea D:411-606)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
   automatically mapped to Pfam PF01434

5. Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
   Pfam PF01434; Peptidase family M41

6. Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
   Uniprot Q9WZ49 411-603

8. Domain d2cead1: 2cea D:411-606 [130338]
   Other proteins in same PDB: d2ceaa2, d2ceab2, d2ceac2, d2cead2, d2ceae2, d2ceaf2
   automated match to d2ce7a1
   complexed with adp, mg, zn

Details for d2cead1

PDB Entry: 2cea, 2.75 Å

PDB Description: cell division protein ftsh

PDB Compounds: (D:) cell division protein ftsh

SCOPe Domain Sequences for d2cead1:

Sequence, based on SEQRES records:

>d2cead1 a.269.1.1 (D:411-606) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilseefe

Sequence, based on observed residues (ATOM records):

>d2cead1 a.269.1.1 (D:411-606) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgyylvsrnelldkltallggra
aeevvfgdvtsgaandierateiarnmvcqlgmseelgplawglrnyseevaskideevk
kivtncyerakeiirkyrkqldniveilleketiegdelrrilseefe

Timeline for d2cead1:

• d2cead1 first appeared in SCOP 1.73
  
• d2cead1 appears in SCOPe 2.06
  
• d2cead1 appears in the current release, SCOPe 2.08