Lineage for d2cead2 (2cea D:150-402)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479033Protein AAA domain of cell division protein FtsH [82418] (3 species)
    ATP-dependent protease
  7. 2479036Species Thermotoga maritima [TaxId:2336] [142325] (3 PDB entries)
    Uniprot Q9WZ49 150-402
  8. 2479049Domain d2cead2: 2cea D:150-402 [130339]
    Other proteins in same PDB: d2ceaa1, d2ceab1, d2ceac1, d2cead1, d2ceae1, d2ceaf1
    automated match to d2ce7a2
    complexed with adp, mg, zn

Details for d2cead2

PDB Entry: 2cea (more details), 2.75 Å

PDB Description: cell division protein ftsh
PDB Compounds: (D:) cell division protein ftsh

SCOPe Domain Sequences for d2cead2:

Sequence, based on SEQRES records: (download)

>d2cead2 c.37.1.20 (D:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgrhr
gaglggghdereqtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvd
ppdmlgrkkileihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdki
tmkdfeeaidrvi

Sequence, based on observed residues (ATOM records): (download)

>d2cead2 c.37.1.20 (D:150-402) AAA domain of cell division protein FtsH {Thermotoga maritima [TaxId: 2336]}
ykpsgnkrvtfkdvggaeeaieelkevveflkdpskfnrigarmpkgillvgppgtgktl
laravageanvpffhisgsdfvelfvgvgaarvrdlfaqakahapcivfideidavgere
qtlnqllvemdgfdskegiivmaatnrpdildpallrpgrfdkkivvdppdmlgrkkile
ihtrnkplaedvnleiiakrtpgfvgadlenlvneaallaaregrdkitmkdfeeaidrv
i

SCOPe Domain Coordinates for d2cead2:

Click to download the PDB-style file with coordinates for d2cead2.
(The format of our PDB-style files is described here.)

Timeline for d2cead2: