Lineage for d2c7pa_ (2c7p A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145958Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2146003Protein automated matches [190244] (3 species)
    not a true protein
  7. 2146008Species Haemophilus haemolyticus [TaxId:726] [187017] (6 PDB entries)
  8. 2146009Domain d2c7pa_: 2c7p A: [130080]
    automated match to d10mha_
    protein/DNA complex; complexed with cit, epe, sah, so4

Details for d2c7pa_

PDB Entry: 2c7p (more details), 1.7 Å

PDB Description: hhai dna methyltransferase complex with oligonucleotide containing 2- aminopurine opposite to the target base (gcgc:gmpc) and sah
PDB Compounds: (A:) modification methylase hhai

SCOPe Domain Sequences for d2c7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7pa_ c.66.1.26 (A:) automated matches {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d2c7pa_:

Click to download the PDB-style file with coordinates for d2c7pa_.
(The format of our PDB-style files is described here.)

Timeline for d2c7pa_: