PDB entry 2c7p

View 2c7p on RCSB PDB site
Description: HhaI DNA methyltransferase complex with oligonucleotide containing 2- aminopurine opposite to the target base (GCGC:GMPC) and SAH
Class: transferase/DNA
Keywords: base flipping, restriction system, transferase-DNA complex
Deposited on 2005-11-25, released 2005-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c7pa_
  • Chain 'C':
    Compound: 5'-d(*g*gp*ap*tp*gp*(5cm*2pr)*cp*tp*gp*ap*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: 5'-d(*g*tp*cp*ap*gp*cp*gp*cp*ap*tp*cp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: SAH, SO4, EPE, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c7pA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.