Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) |
Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins) |
Protein DNA methylase HhaI [53367] (1 species) |
Species Haemophilus haemolyticus [TaxId:726] [53368] (20 PDB entries) |
Domain d2c7pa1: 2c7p A:1-327 [130080] automatically matched to d10mha_ complexed with 5cm, a1p, cit, epe, sah, so4 |
PDB Entry: 2c7p (more details), 1.7 Å
SCOP Domain Sequences for d2c7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk qfgnsvvinvlqyiaynigsslnfkpy
Timeline for d2c7pa1: