Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.15: A20-like zinc finger [144187] (1 protein) Pfam PF01754 |
Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species) binds to ubiquitin with the extended C-terminal helix |
Species Human (Homo sapiens) [TaxId:9606] [144190] (2 PDB entries) Uniprot Q9UJ41 17-74 |
Domain d2c7ni1: 2c7n I:17-74 [130076] Other proteins in same PDB: d2c7nb1, d2c7nd1, d2c7nf1, d2c7nh1, d2c7nj1, d2c7nl1 automatically matched to 2C7M A:18-75 complexed with zn |
PDB Entry: 2c7n (more details), 2.1 Å
SCOPe Domain Sequences for d2c7ni1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7ni1 g.39.1.15 (I:17-74) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]} llckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassqs
Timeline for d2c7ni1: