Lineage for d2c7na1 (2c7n A:18-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036119Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
    Pfam PF01754
  6. 3036120Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
    binds to ubiquitin with the extended C-terminal helix
  7. 3036126Species Human (Homo sapiens) [TaxId:9606] [144190] (2 PDB entries)
    Uniprot Q9UJ41 17-74
  8. 3036127Domain d2c7na1: 2c7n A:18-73 [130069]
    Other proteins in same PDB: d2c7nb1, d2c7nd1, d2c7nf1, d2c7nh1, d2c7nj1, d2c7nl1
    automatically matched to 2C7M A:18-75
    complexed with zn

Details for d2c7na1

PDB Entry: 2c7n (more details), 2.1 Å

PDB Description: human rabex-5 residues 1-74 in complex with ubiquitin
PDB Compounds: (A:) rab guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d2c7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c7na1 g.39.1.15 (A:18-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Human (Homo sapiens) [TaxId: 9606]}
lckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq

SCOPe Domain Coordinates for d2c7na1:

Click to download the PDB-style file with coordinates for d2c7na1.
(The format of our PDB-style files is described here.)

Timeline for d2c7na1: