Lineage for d2c78a3 (2c78 A:9-212)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein automated matches [190047] (37 species)
    not a true protein
  7. Species Thermus thermophilus HB8 [TaxId:300852] [255082] (2 PDB entries)
  8. Domain d2c78a3: 2c78 A:9-212 [130039]
    Other proteins in same PDB: d2c78a1, d2c78a2
    automated match to d1b23p3
    complexed with gnp, mg, pul

Details for d2c78a3

PDB Entry: 2c78 (more details), 1.4 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic pulvomycin
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d2c78a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c78a3 c.37.1.8 (A:9-212) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d2c78a3 are not available.

Timeline for d2c78a3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c78a1, d2c78a2