Lineage for d2c78a2 (2c78 A:313-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794082Species Thermus thermophilus HB8 [TaxId:300852] [255084] (2 PDB entries)
  8. 2794083Domain d2c78a2: 2c78 A:313-405 [130038]
    Other proteins in same PDB: d2c78a1, d2c78a3
    automated match to d1b23p2
    complexed with gnp, mg, pul

Details for d2c78a2

PDB Entry: 2c78 (more details), 1.4 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic pulvomycin
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d2c78a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c78a2 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d2c78a2:

Click to download the PDB-style file with coordinates for d2c78a2.
(The format of our PDB-style files is described here.)

Timeline for d2c78a2: