SCOPe 2.08: Domain d2c5ab_: 2c5a B:

Lineage for d2c5ab_ (2c5a B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187183] (5 PDB entries)

8. Domain d2c5ab_: 2c5a B: [129895]
   Other proteins in same PDB: d2c5aa1
   automated match to d2c59a1
   complexed with btb, fmt, gdc, nad

Details for d2c5ab_

PDB Entry: 2c5a, 1.4 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),y174f, with gdp- beta-l-galactose bound in the active site

PDB Compounds: (B:) GDP-mannose-3', 5'-epimerase

SCOPe Domain Sequences for d2c5ab_:

Sequence; same for both SEQRES and ATOM records:

>d2c5ab_ c.2.1.2 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ytykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfc
defhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaar
ingikrffyassaciypefkqlettnvslkesdawpaepqdafgleklateelckhynkd
fgiecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidec
vegvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnn
likeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslr
a

Timeline for d2c5ab_:

• d2c5ab_ first appeared in SCOP 1.73, called d2c5ab1
  
• d2c5ab_ appears in SCOPe 2.07