Lineage for d2c5aa1 (2c5a A:13-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842489Protein GDP-mannose-3', 5'-epimerase [141890] (1 species)
  7. 2842490Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141891] (4 PDB entries)
    Uniprot Q93VR3 13-374! Uniprot Q93VR3 13-375
  8. 2842491Domain d2c5aa1: 2c5a A:13-375 [129894]
    Other proteins in same PDB: d2c5ab_
    complexed with btb, fmt, gdc, nad
    has additional subdomain(s) that are not in the common domain

Details for d2c5aa1

PDB Entry: 2c5a (more details), 1.4 Å

PDB Description: gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),y174f, with gdp- beta-l-galactose bound in the active site
PDB Compounds: (A:) GDP-mannose-3', 5'-epimerase

SCOPe Domain Sequences for d2c5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
tykelereqywpsenlkisitgaggfiashiarrlkheghyviasdwkknehmtedmfcd
efhlvdlrvmenclkvtegvdhvfnlaadmggmgfiqsnhsvimynntmisfnmieaari
ngikrffyassaciypefkqlettnvslkesdawpaepqdafgleklateelckhynkdf
giecrigrfhniygpfgtwkggrekapaafcrkaqtstdrfemwgdglqtrsftfidecv
egvlrltksdfrepvnigsdemvsmnemaemvlsfeekklpihhipgpegvrgrnsdnnl
ikeklgwapnmrlkeglrityfwikeqiekekakgsdvslygsskvvgtqapvqlgslra
adg

SCOPe Domain Coordinates for d2c5aa1:

Click to download the PDB-style file with coordinates for d2c5aa1.
(The format of our PDB-style files is described here.)

Timeline for d2c5aa1: