SCOPe 2.08: Domain d2c4kf2: 2c4k F:167-350

Lineage for d2c4kf2 (2c4k F:167-350)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein PRPP synthetase-associated protein 1 [142563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry)
   Uniprot Q14558 167-350! Uniprot Q14558 7-166

8. Domain d2c4kf2: 2c4k F:167-350 [129835]
   automated match to d2c4ka2
   complexed with so4, tam

Details for d2c4kf2

PDB Entry: 2c4k, 2.65 Å

PDB Description: crystal structure of human phosphoribosylpyrophosphate synthetase- associated protein 39 (pap39)

PDB Compounds: (F:) phosphoribosyl pyrophosphate synthetase-associated protein 1

SCOPe Domain Sequences for d2c4kf2:

Sequence, based on SEQRES records:

>d2c4kf2 c.61.1.2 (F:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvknatvhp
glelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmath
gilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesma
ylfr

Sequence, based on observed residues (ATOM records):

>d2c4kf2 c.61.1.2 (F:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihppitvvgdvggriaiivddiiddvesf
vaaaeilkergaykiyvmathgilsaeaprlieessvdevvvtntvphevqklqcpkikt
vdislilseairrihngesmaylfr

Timeline for d2c4kf2:

• d2c4kf2 first appeared in SCOP 1.73
  
• d2c4kf2 appears in SCOPe 2.07