Lineage for d2c4ke2 (2c4k E:167-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891815Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
    duplication: consists of two domains of this fold
  6. 2891847Protein PRPP synthetase-associated protein 1 [142563] (1 species)
  7. 2891848Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry)
    Uniprot Q14558 167-350! Uniprot Q14558 7-166
  8. 2891858Domain d2c4ke2: 2c4k E:167-350 [129833]
    automated match to d2c4ka2
    complexed with so4, tam

Details for d2c4ke2

PDB Entry: 2c4k (more details), 2.65 Å

PDB Description: crystal structure of human phosphoribosylpyrophosphate synthetase- associated protein 39 (pap39)
PDB Compounds: (E:) phosphoribosyl pyrophosphate synthetase-associated protein 1

SCOPe Domain Sequences for d2c4ke2:

Sequence, based on SEQRES records: (download)

>d2c4ke2 c.61.1.2 (E:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvknatvhp
glelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmath
gilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesma
ylfr

Sequence, based on observed residues (ATOM records): (download)

>d2c4ke2 c.61.1.2 (E:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
nyrnavivakspdaakraqsyaerlrlglavihppitvvgdvggriaiivddiiddvesf
vaaaeilkergaykiyvmathgilsaeaprlieessvdevvvtntvphevqklqcpkikt
vdislilseairrihngesmaylfr

SCOPe Domain Coordinates for d2c4ke2:

Click to download the PDB-style file with coordinates for d2c4ke2.
(The format of our PDB-style files is described here.)

Timeline for d2c4ke2: