![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
![]() | Protein PRPP synthetase-associated protein 1 [142563] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry) Uniprot Q14558 167-350! Uniprot Q14558 7-166 |
![]() | Domain d2c4kb2: 2c4k B:167-350 [129827] automated match to d2c4ka2 complexed with so4, tam |
PDB Entry: 2c4k (more details), 2.65 Å
SCOPe Domain Sequences for d2c4kb2:
Sequence, based on SEQRES records: (download)
>d2c4kb2 c.61.1.2 (B:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} nyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvknatvhp glelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmath gilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesma ylfr
>d2c4kb2 c.61.1.2 (B:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} nyrnavivakspdaakraqsyaerlrlglavihppitvvgdvggriaiivddiiddvesf vaaaeilkergaykiyvmathgilsaeaprlieessvdevvvtntvphevqklqcpkikt vdislilseairrihngesmaylfr
Timeline for d2c4kb2: