![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein Barnase [81305] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
![]() | Domain d2c4bb1: 2c4b B:3-110 [129803] Other proteins in same PDB: d2c4ba2, d2c4bb2 automatically matched to d1b3sa_ complexed with 2pe, edo, fmt, gol, mes, so4, unx; mutant |
PDB Entry: 2c4b (more details), 1.3 Å
SCOPe Domain Sequences for d2c4bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4bb1 d.1.1.2 (B:3-110) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
Timeline for d2c4bb1: