SCOPe 2.08: Domain d2c31a2: 2c31 A:7-194

Lineage for d2c31a2 (2c31 A:7-194)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Oxalyl-CoA decarboxylase [142205] (1 species)

7. Species Oxalobacter formigenes [TaxId:847] [142206] (6 PDB entries)
   Uniprot P40149 7-194

8. Domain d2c31a2: 2c31 A:7-194 [129705]
   Other proteins in same PDB: d2c31a1, d2c31a3, d2c31b1, d2c31b3
   complexed with adp, mg, tzd

Details for d2c31a2

PDB Entry: 2c31, 1.73 Å

PDB Description: crystal structure of oxalyl-coa decarboxylase in complex with the cofactor derivative thiamin-2-thiazolone diphosphate and adenosine diphosphate

PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2c31a2:

Sequence; same for both SEQRES and ATOM records:

>d2c31a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
fkpidpap

Timeline for d2c31a2:

• d2c31a2 first appeared in SCOP 1.73
  
• d2c31a2 appears in SCOPe 2.07