PDB entry 2c31

View 2c31 on RCSB PDB site
Description: crystal structure of oxalyl-coa decarboxylase in complex with the cofactor derivative thiamin-2-thiazolone diphosphate and adenosine diphosphate
Class: lyase
Keywords: oxalyl-coa decarboxylase, oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate
Deposited on 2005-10-03, released 2005-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxalyl-coa decarboxylase
    Species: OXALOBACTER FORMIGENES [TaxId:847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c31a1, d2c31a2, d2c31a3
  • Chain 'B':
    Compound: oxalyl-coa decarboxylase
    Species: OXALOBACTER FORMIGENES [TaxId:847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c31b1, d2c31b2, d2c31b3
  • Heterogens: MG, TZD, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c31A (A:)
    msnddnveltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhag
    yaasiagyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdy
    eemdqmnvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisve
    eankllfkpidpapaqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveet
    gipflpmgmakgllpdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelk
    kyvqidiqanemdsnqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnka
    klagkmtaetpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrl
    dsgtwgvmgigmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnng
    giykgneadpqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpcl
    inamidpdagvesgrikslnvvskvgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c31A (A:)
    veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
    gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
    nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
    fkpidpapaqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflp
    mgmakgllpdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqid
    iqanemdsnqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkm
    taetpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwg
    vmgigmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgn
    eadpqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamid
    pdagve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c31B (B:)
    msnddnveltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhag
    yaasiagyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdy
    eemdqmnvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisve
    eankllfkpidpapaqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveet
    gipflpmgmakgllpdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelk
    kyvqidiqanemdsnqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnka
    klagkmtaetpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrl
    dsgtwgvmgigmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnng
    giykgneadpqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpcl
    inamidpdagvesgrikslnvvskvgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c31B (B:)
    veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
    gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
    nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
    fkpidpapaqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflp
    mgmakgllpdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqid
    iqanemdsnqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkm
    taetpsgmmnysnslgvvrdfmlanpdislvneganaldntrmivdmlkprkrldsgtwg
    vmgigmgycvaaaavtgkpviavegdsafgfsgmeleticrynlpvtviimnnggiykgn
    eadpqpgvisctrltrgrydmmmeafggkgyvantpaelkaaleeavasgkpclinamid
    pdagves