SCOPe 2.08: Domain d2c2wc1: 2c2w C:193-298

Lineage for d2c2wc1 (2c2w C:193-298)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries)

8. Domain d2c2wc1: 2c2w C:193-298 [129702]
   Other proteins in same PDB: d2c2wa2, d2c2wb2, d2c2wc2
   automated match to d1rqpa1
   complexed with 5cd, cl

Details for d2c2wc1

PDB Entry: 2c2w, 2 Å

PDB Description: the fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.

PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c2wc1:

Sequence; same for both SEQRES and ATOM records:

>d2c2wc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2c2wc1:

• d2c2wc1 first appeared in SCOP 1.73
  
• d2c2wc1 appears in SCOPe 2.07