Class b: All beta proteins [48724] (180 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) |
Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [101855] (12 PDB entries) |
Domain d1rqpa1: 1rqp A:193-298 [97754] Other proteins in same PDB: d1rqpa2, d1rqpb2, d1rqpc2 complexed with sam |
PDB Entry: 1rqp (more details), 1.8 Å
SCOPe Domain Sequences for d1rqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqpa1 b.141.1.1 (A:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d1rqpa1:
View in 3D Domains from other chains: (mouse over for more information) d1rqpb1, d1rqpb2, d1rqpc1, d1rqpc2 |