PDB entry 2c2w

View 2c2w on RCSB PDB site
Description: The fluorinase from Streptomyces cattleya is also a chlorinase. Structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
Class: transferase
Keywords: fluorinase, 5'-chloro-5'-deoxyadenosine, fla, bacterial fluorinating enzyme, bacterial chlorinating enzyme, streptomyces cattleya, transferase, chlorinase
Deposited on 2005-09-30, released 2005-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c2wa1, d2c2wa2
  • Chain 'B':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c2wb1, d2c2wb2
  • Chain 'C':
    Compound: 5'-fluoro-5'-deoxyadenosine synthase
    Species: STREPTOMYCES CATTLEYA [TaxId:29303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c2wc1, d2c2wc2
  • Heterogens: 5CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2wA (A:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2wA (A:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2wB (B:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2wB (B:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c2wC (C:)
    maanstrrpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryiv
    dlprffpegtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyi
    apnngllttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgr
    pledheivrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltl
    dgvlpfeapltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2wC (C:)
    rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
    ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
    vrfnrpaveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfe
    apltptfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea