Lineage for d2c2wb2 (2c2w B:8-192)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923098Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2923099Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2923100Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 2923101Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 2923102Species Streptomyces cattleya [TaxId:29303] [102525] (12 PDB entries)
  8. 2923119Domain d2c2wb2: 2c2w B:8-192 [129701]
    Other proteins in same PDB: d2c2wa1, d2c2wb1, d2c2wc1
    automated match to d1rqpa2
    complexed with 5cd, cl

Details for d2c2wb2

PDB Entry: 2c2w (more details), 2 Å

PDB Description: the fluorinase from streptomyces cattleya is also a chlorinase. structure of 5'-chloro-5'-deoxyadenosine crystallised in the fluorinase.
PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2c2wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2wb2 c.132.1.1 (B:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d2c2wb2:

Click to download the PDB-style file with coordinates for d2c2wb2.
(The format of our PDB-style files is described here.)

Timeline for d2c2wb2: