Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rac3 [142255] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142256] (1 PDB entry) Uniprot P60763 3-177 |
Domain d2c2ha1: 2c2h A:3-177 [129668] Other proteins in same PDB: d2c2hb_ complexed with ca, gdp, mg, so4 |
PDB Entry: 2c2h (more details), 1.85 Å
SCOPe Domain Sequences for d2c2ha1:
Sequence, based on SEQRES records: (download)
>d2c2ha1 c.37.1.8 (A:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]} aikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagqe dydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrdd kdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl
>d2c2ha1 c.37.1.8 (A:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]} aikcvvvgdgavgktcllisyttnafpgdnysanvmvdgkpvnlglwdtagqedydrlrp lsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkdtierl rdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl
Timeline for d2c2ha1: